Description
LL-37 Technical Overview
LL-37 is a naturally occurring 37-amino-acid human antimicrobial peptide produced through processing of the cathelicidin precursor hCAP18.
It has a cationic, amphipathic structure associated with interactions involving microbial membranes and selected mammalian signaling pathways.
LL-37 has been studied in experimental microbiology, epithelial biology, innate immunity, and peptide-membrane research.
Compound Specifications
| Property | Value |
|---|---|
| Compound Name | LL-37 |
| Alternative Name | Human cathelicidin antimicrobial peptide |
| Related Gene | CAMP |
| Parent Protein | hCAP18 |
| Sequence | [LL-37, 37 aa] |
| Sequence Length | 37 residues |
| Classification | Cationic antimicrobial peptide |
| Source | Synthetic research preparation |
| Vial Content | 5mg |
Storage and Handling
- Follow manufacturer-validated stability recommendations.
- Protect the compound from moisture and contamination.
- Use procedures appropriate for antimicrobial peptide research.
Lyophilized Format
LL-37 may be manufactured in lyophilized form. Physical characteristics and stability depend on the supplied preparation.
Research Use Disclaimer
LL-37 is not FDA-approved for human therapeutic use. This material is intended for laboratory research only and not for human or veterinary administration.
Frequently Asked Questions
What Is LL-37 5mg?
A research preparation of the 37-amino-acid human cathelicidin peptide.
What Is Its Primary Research Area?
Antimicrobial peptide activity and innate immune signaling.
What Is the Parent Protein?
hCAP18.
Does LL-37 Have an Established Therapeutic Use?
No FDA-approved therapeutic use has been established for LL-37.
LL-37 Research Overview
LL-37 has been investigated as an endogenous peptide involved in human host defense.
Antimicrobial Activity Research
In vitro studies have examined the activity of LL-37 against selected microbial organisms.
Membrane Biology
Research investigates how the peptide’s charge and amphipathic properties influence interactions with lipid membranes.
Innate Immune Signaling
Experimental studies have explored LL-37-associated immune-cell and epithelial responses.
Research Applications
| Research Area | In Vitro Application |
|---|---|
| Microbiology | Antimicrobial activity assays |
| Membrane Chemistry | Peptide-lipid interaction studies |
| Innate Immunity | Cellular signaling investigations |
References
- Vandamme D, Landuyt B, Luyten W, Schoofs L. (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology. View publication.
- Turner J, et al. (1998). Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils. Antimicrobial Agents and Chemotherapy. View publication.
Certificate of Analysis (COA)
Batch documentation should establish the LL-37 amino acid sequence, molecular identity, purity, and actual content.
Reviews
There are no reviews yet.